DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG1299

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster


Alignment Length:276 Identity:83/276 - (30%)
Similarity:125/276 - (45%) Gaps:47/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LDPACGIRTQSRTAY--RIINGHTAKYNSSPWMVFL---HSTTDMFVCGGSLITDKLVLTAAHCF 88
            ::..||    |...|  :|:.|..::..:.||:..|   ..:...|.|||:|||.:.|||||||.
  Fly   247 VEEGCG----STVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCI 307

  Fly    89 IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGF----KHKLYDPNTHANDIAILRLSKSV 149
            ..:...| ||||::.:...| ||:         ||...    .|..|:.....:|:|||.|.::|
  Fly   308 RQDLQFV-RLGEHDLSTDTE-TGH---------VDINIARYVSHPDYNRRNGRSDMAILYLERNV 361

  Fly   150 VYRDNIRPICVVWDH----RWRHYLDKIDLLTATGWGKTQMESDSDA--LQTLDIRRQPPDVCAK 208
            .:...|.|||:  .|    |.:.|:..:..:  .||||| ||....|  |..|.|......||.:
  Fly   362 EFTSKIAPICL--PHTANLRQKSYVGYMPFV--AGWGKT-MEGGESAQVLNELQIPIYDNKVCVQ 421

  Fly   209 FIGQT---IAGNQF-----CAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQ 263
            ...:.   .:.:||     |||  :...:.|.|||||||.....::...||..:|:.|| ...|.
  Fly   422 SYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSY-GIGCA 485

  Fly   264 KASVFTDVLSHAEFIL 279
            :.:| ..|.|..::.:
  Fly   486 RPNV-PGVYSSTQYFM 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 79/256 (31%)
Tryp_SPc 45..278 CDD:238113 79/255 (31%)
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 79/259 (31%)
Tryp_SPc 261..503 CDD:238113 79/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.