DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG3650

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:288 Identity:78/288 - (27%)
Similarity:118/288 - (40%) Gaps:62/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGG 73
            |.|  ::.:.|||....|..:.|            ||:.|.|...::....|........|.|||
  Fly     4 PLF--LLQLTQLLLGLASGQIQP------------RIVGGTTTTLSAVGGFVVNLRYDGTFYCGG 54

  Fly    74 SLITDKLVLTAAHCF-------IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLY 131
            ||:|...|:|||||.       |..|..|::|.:....|..          ..:.:..||.    
  Fly    55 SLVTSSHVVTAAHCLKGYQASRITVQGGVSKLSQSGVVRRV----------ARYFIPNGFS---- 105

  Fly   132 DPNTHAN-DIAILRLSKSVVYRDNIR--PICVVWDHRWR--HYLDKIDLLTATGWGKTQM--ESD 189
              ::..| |:.::|| :|.:....|.  |:|.|   :|.  :|      :..:|||.|:.  .|.
  Fly   106 --SSSLNWDVGVIRL-QSALTGSGITTIPLCQV---QWNPGNY------MRVSGWGTTRYGNSSP 158

  Fly   190 SDALQTLDIRRQPPDVCAK-FIGQ-TIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQV 252
            |:.|:|:.|:.....||.: :.|: |:..:.|||.....:.|:||||   |.||........|..
  Fly   159 SNQLRTVRIQLIRKKVCQRAYQGRDTLTASTFCARTGGKDSCSGDSG---GGVIFKNQLCGIVSW 220

  Fly   253 GIASYTNRNCQKASVFTDVLSHAEFILR 280
            |:..   .|.|...|:|.|.....||||
  Fly   221 GLGC---ANAQYPGVYTSVHRVRSFILR 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/249 (27%)
Tryp_SPc 45..278 CDD:238113 66/248 (27%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 67/249 (27%)
Tryp_SPc 26..243 CDD:238113 66/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.