DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG15873

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:312 Identity:79/312 - (25%)
Similarity:120/312 - (38%) Gaps:93/312 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FVGIIL------------------MFQLLHSGCSQFLDPACGIRTQS-RTAYRIINGHTAKYNSS 56
            |:|:||                  .|::|.||         |.:.:| |.:..:::..|..|   
  Fly     7 FLGLILSTSLSDADLGVIGDISDETFEMLISG---------GYKPKSNRLSRHVVSIRTKNY--- 59

  Fly    57 PWMVFLHSTTDMFVCGGSLITDKLVLTAAHCF--------------IANQHLVARLGEYERTRSE 107
                 :....|...|.|.|::.:.|||||||.              :...| :.||..|:.:   
  Fly    60 -----VRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGH-ITRLAVYDES--- 115

  Fly   108 ECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRD-NIRPICVVWDHRWRHYLD 171
                   :||.   ||....|..|: ....||:||||||:.|...: ::.|:.:    |....:.
  Fly   116 -------DFRS---VDRLVVHPEYE-RYKKNDLAILRLSERVQSSNHDVLPLLM----RKTANVT 165

  Fly   172 KIDLLTATGWGKTQMESD-SDALQTLDIRRQPPDVCAKFIGQTIAGNQFC---AGNWDSNLCNGD 232
            ..|.....|||:...... |:.|..||:..:||.:|.|......|.:..|   .|  :|..|.||
  Fly   166 YGDTCITLGWGQIYQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVG--ESMNCAGD 228

  Fly   233 SGGPL---GAVITHKNTQRFVQVGIASYTNRNCQ--KASVFTDVLSHAEFIL 279
            .||||   ||:        |..:|    .:..|.  ||..|...|.:.::||
  Fly   229 MGGPLLCKGAL--------FGLIG----GHMGCAGGKAMKFLSFLYYKDWIL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 66/257 (26%)
Tryp_SPc 45..278 CDD:238113 66/256 (26%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 66/263 (25%)
Tryp_SPc 59..250 CDD:238113 60/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.