DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG13430

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:258 Identity:76/258 - (29%)
Similarity:113/258 - (43%) Gaps:52/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHC---FIANQHLVARLGEYERTR 105
            ||:.|........|..|.|...| ...|||::|:..::||||||   :...|:.|.|.|..:.|:
  Fly    31 RIVGGWETHITFFPHQVSLQLGT-RHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSSDWTK 94

  Fly   106 SEECTGYYCNFRE--EHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRH 168
            .    |.|...::  .|       .:.:||....|||||::|.:.:||..:||||.:....    
  Fly    95 G----GSYIRVKKIIPH-------PEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSK---- 144

  Fly   169 YLDKIDLLTAT------GWGKT---QMESDSDALQTLDIRRQPPDVCAK--FIGQTIAGNQFCAG 222
                 |::..|      |||.|   ||:.:.....|: :..:..:.||:  |...|:....||||
  Fly   145 -----DIIMPTAQLFVSGWGSTSISQMQPEKRLRYTV-VHLRDQNQCARNYFGAGTVTNTMFCAG 203

  Fly   223 NW----DSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA---SVFTDVLSHAEFI 278
            ..    ||  |.|||||||...|    ..|....||.|: ...|..|   .::|.|.::.::|
  Fly   204 TQAGGRDS--CQGDSGGPLVTSI----DGRLKLYGIVSW-GFGCANAMFPGIYTKVSAYDDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 75/256 (29%)
Tryp_SPc 45..278 CDD:238113 74/255 (29%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 75/256 (29%)
Tryp_SPc 32..262 CDD:238113 75/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.