DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG32270

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:277 Identity:75/277 - (27%)
Similarity:116/277 - (41%) Gaps:47/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKL 80
            |||.:|      ::..:.....:.|.:.||:.||.:.....|.||.:....: |.|||||:|.:.
  Fly     8 LMFWML------WIRESVAEELELRRSPRIVGGHPSDVWHQPHMVNIRRRGN-FECGGSLVTPRC 65

  Fly    81 VLTAAHCFIAN--QHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAIL 143
            |||||||....  ...|.|.|          ..|..:.|....|........|...|..:|:|:|
  Fly    66 VLTAAHCLNDGNPSDFVVRGG----------VTYLSDMRNSRYVRKILMPSAYSRTTLDHDVALL 120

  Fly   144 RLSKSVVYRDNIRPICV-VWDHRWRHYLDKIDLLTATGWGKTQMESDS--DALQTLDIRRQPPDV 205
            :| |..:.....:||.: |...|...:      :..:|||.|...|.|  :.||::.::..|...
  Fly   121 QL-KQPLQASIAKPISLAVRSPRPGSF------VRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRE 178

  Fly   206 CAKFIG--QTIAGNQFCA---GNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTN-RNC-- 262
            |.....  :.|..:.|||   |..|:  |.||||||    :.:.|.   :.||:.|:.. ..|  
  Fly   179 CRDLYRGYRNITSSMFCASVPGLKDA--CAGDSGGP----VVNSNG---ILVGVVSWGRAHRCAA 234

  Fly   263 -QKASVFTDVLSHAEFI 278
             ....|::||...:::|
  Fly   235 RDSPGVYSDVSYLSDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/247 (28%)
Tryp_SPc 45..278 CDD:238113 68/246 (28%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 69/247 (28%)
Tryp_SPc 31..254 CDD:238113 69/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.