DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG9897

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:269 Identity:65/269 - (24%)
Similarity:99/269 - (36%) Gaps:65/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCF--IANQHLVARLGEYERTRS 106
            |||||:|.....:||...: .......|||::|:...:||||.|.  .:.:.:..|||......|
  Fly    22 RIINGNTVNIKDAPWYASI-IVNSKLKCGGAIISKNYILTAAKCVDGYSARSIQVRLGTSSCGTS 85

  Fly   107 EECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLD 171
            ....| .|..:         .|..|......|::|:|:..:.:...|.|:||         ...|
  Fly    86 GSIAG-ICKVK---------VHSQYSSWRFDNNLALLKTCELLNTTDEIKPI---------ERAD 131

  Fly   172 KI----DLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQ------TIAGNQFCAGNWD- 225
            |:    .....||.| .:..:..|.:..|.|.....:.|.:...|      .|...:.||.:|. 
  Fly   132 KVPDDNSRANVTGCG-GRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRILSQKQCAADWKV 195

  Fly   226 ---------SNL-----------CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQ-KASVFT 269
                     |:|           |:.|.|.||  ||.:|      .|||.|  ...|. |..|:.
  Fly   196 IPFYLLKGISDLTICTKSPGKGACSTDRGSPL--VIDNK------LVGILS--RAGCSIKPDVYA 250

  Fly   270 DVLSHAEFI 278
            ::|.|..::
  Fly   251 NILGHTNWL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 65/267 (24%)
Tryp_SPc 45..278 CDD:238113 64/266 (24%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 65/266 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.