DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG13527

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:288 Identity:69/288 - (23%)
Similarity:107/288 - (37%) Gaps:87/288 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TAYRIING-HTAKYNSSP------------WMVFLHSTT------DMFVCGGSLITDKLVLTAAH 86
            |...|::| |..|..|||            ::|.:.|.|      |...|||.|::::.|:||||
  Fly    13 TVMVILSGAHRMKRLSSPKFHGDETLELAKYVVSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAH 77

  Fly    87 CFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKL-YDP-NTHANDIAILRLSKSV 149
            |.:....::                |...:.   :|.||..|:| |.| .:..:.::.|.:.|:.
  Fly    78 CVMGQSKIM----------------YKARWL---LVVAGSPHRLRYTPGKSVCSPVSSLYVPKNF 123

  Fly   150 VYRDNIRPICVVWDHRWRHYLDKIDLL-------------TATGWGKTQMESD-SDALQTLDIRR 200
            ...:......:....:......:|..|             |..|||:...... :..:..:|:..
  Fly   124 TMHNTFNMALMKLQEKMPSNDPRIGFLHLPKEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVDVVL 188

  Fly   201 QPPDVCAKFI-----GQTIAGNQFCAGNW--DSNLCNGDSGGPL--GAVITHKNTQRFVQVGIAS 256
            ....||..:.     |...|||    .||  |:..|:||.|.||  |.|:          |||.:
  Fly   189 MDNAVCKTYFRHYGDGMMCAGN----NNWTIDAEPCSGDIGSPLLSGKVV----------VGIVA 239

  Fly   257 Y------TNRNCQKASVFTDVLSHAEFI 278
            |      ||    ..||:|||.|...:|
  Fly   240 YPIGCGCTN----IPSVYTDVFSGLRWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/283 (24%)
Tryp_SPc 45..278 CDD:238113 67/282 (24%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 61/258 (24%)
Tryp_SPc 43..263 CDD:214473 60/256 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.