DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG10764

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:253 Identity:82/253 - (32%)
Similarity:131/253 - (51%) Gaps:17/253 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIAN 91
            :||:..|||.|:.    :|..|..|...:|.||..:.:::| |.|||::|..:.||:||||.:..
  Fly    24 KFLETPCGISTRP----KISGGDDAAEPNSIWMAAIFNSSD-FQCGGTIIHMRFVLSAAHCLVRG 83

  Fly    92 QHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIR 156
            ..|..|||  .|..:|...        .|.|...|.|..:..:.:.|||.:|:||:|:||...::
  Fly    84 YDLYVRLG--ARNINEPAA--------VHTVINVFVHHDFIASEYRNDIGLLQLSESIVYTVRVQ 138

  Fly   157 PICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCA 221
            |||:..|...:..::|:....|.|||....:. |..|||:.:.....:.|.:.:...:...|.||
  Fly   139 PICIFLDPALKGSVEKLKTFRALGWGNRNGKL-SIMLQTIYLLHLKRNECKRKLNFNLNSRQICA 202

  Fly   222 GNWDSNLCNGDSGGPLGAVITHKNTQRF-VQVGIASYTNRNCQKASVFTDVLSHAEFI 278
            |..:.:.|.|||||||...|...:.:.: ||:||.|:.:..|:...|:|||.|:.::|
  Fly   203 GTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGVYTDVTSYVDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 75/234 (32%)
Tryp_SPc 45..278 CDD:238113 75/233 (32%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 75/234 (32%)
Tryp_SPc 38..263 CDD:238113 76/235 (32%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463386
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.840

Return to query results.
Submit another query.