DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Tmprss11b

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001004020.1 Gene:Tmprss11b / 365265 RGDID:1303278 Length:420 Species:Rattus norvegicus


Alignment Length:279 Identity:77/279 - (27%)
Similarity:122/279 - (43%) Gaps:33/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GIILMFQLLHSGCSQFLDPACGIRTQSRTAY-RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLI 76
            |.:.:.::......:.::..||.|.:....| ||..|.||:....||...|. ......||.|||
  Rat   156 GSLKLTEITKVDAEKIINNRCGRRPRMSATYDRITGGSTAQKGEWPWQASLR-VNGKHHCGASLI 219

  Fly    77 TDKLVLTAAHCFIAN---QHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHAN 138
            .::.:|||||||:..   ::|....|    ||   .|..|.    :|.|:....|:.|....|.:
  Rat   220 GERFLLTAAHCFLRTNNPKNLTVSFG----TR---VTPAYM----QHYVEEVIIHEDYVKGQHHD 273

  Fly   139 DIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSD-ALQTLDIRRQP 202
            |:||::|::.|.:|:::..:|:   ..........:.:..||||.......|. .||...|:...
  Rat   274 DVAIIKLTEKVSFRNDVHRVCL---PEATQVFPPGEGVVVTGWGSLSYNGKSPLLLQKASIKIID 335

  Fly   203 PDVC--AKFIGQTIAGNQFCAGNWDS--NLCNGDSGGPLGAVITHKNTQR-FVQVGIASYTNRNC 262
            .:.|  .:..|..|.....|||..:.  :.|.|||||||    .|.|::. :..|||.|: ...|
  Rat   336 TNACNSEEAYGGRIMDTMLCAGYMEGYVDACQGDSGGPL----VHPNSRDIWYLVGIVSW-GHEC 395

  Fly   263 ---QKASVFTDVLSHAEFI 278
               .|..|:..|.|:.::|
  Rat   396 GRVNKPGVYMRVTSYRDWI 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 71/245 (29%)
Tryp_SPc 45..278 CDD:238113 70/244 (29%)
Tmprss11bNP_001004020.1 SEA 50..144 CDD:279699
Tryp_SPc 188..414 CDD:214473 71/245 (29%)
Tryp_SPc 189..417 CDD:238113 71/246 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.