DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Prss39

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_006244779.1 Gene:Prss39 / 363215 RGDID:1309276 Length:371 Species:Rattus norvegicus


Alignment Length:348 Identity:84/348 - (24%)
Similarity:128/348 - (36%) Gaps:90/348 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ALIGVPTFVGIILMFQLLHSGCSQ-------FLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVF 61
            ||....|.:|.:..   .:..|.:       .:...||   :::...:|..|..||....||...
  Rat    30 ALTNTSTHIGRLAQ---TNGPCPEGKCLVAGIVSTVCG---KTKFQGKIYGGSIAKAERWPWQAS 88

  Fly    62 LHSTTDMF----VCGGSLITDKLVLTAAHCF---IANQHLVARLGEYERTRSEECTGYYCNFREE 119
            |     :|    :||..||....|.:|||||   :........||..|.:...       |:..:
  Rat    89 L-----IFRGRHICGAVLIDKNWVASAAHCFKRSLKPSDYRILLGYNELSNPS-------NYSRQ 141

  Fly   120 HMVDAGFKHKLYDP-NTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGK 183
            ..:.....|:.|:. ::...||.:::|...|.|..:|.|:||. |...:...|  :....:||| 
  Rat   142 MTLSKVIVHEDYNKLHSQEKDIVLIQLHLPVRYSSHIFPVCVP-DQTTKEPSD--ESCWISGWG- 202

  Fly   184 TQMESDSDALQT----LD--IRRQPPDVCAKFIGQT----------IAGNQFCAGNW--DSNLCN 230
              |.:|...||.    ||  :.......|..|. ||          |..:..|||:.  ..:.|.
  Rat   203 --MVTDDKFLQAPFPLLDSEVFLMNDQECEAFF-QTPQISITEYDAIKDDMICAGDITNQKSTCR 264

  Fly   231 GDSGGPLGAVITHKNTQRFVQVGIASYTNRNC----QKASVFTDVLSHAEFI------------- 278
            |||||||..::    ...:..||:||::.. |    ...|:||.|...:::|             
  Rat   265 GDSGGPLVCLL----DSYWYLVGLASWSGA-CLEPIHSPSIFTRVSHFSDWIEKKKADTPDVDPS 324

  Fly   279 ----------LRVWRMYGKGQTL 291
                      |..||.|..|.||
  Rat   325 LAPLEETAPSLIGWRNYSAGTTL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/263 (26%)
Tryp_SPc 45..278 CDD:238113 69/262 (26%)
Prss39XP_006244779.1 Tryp_SPc 71..311 CDD:214473 69/263 (26%)
Tryp_SPc 72..314 CDD:238113 70/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.