DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Ctrc

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001071117.1 Gene:Ctrc / 362653 RGDID:1308379 Length:268 Species:Rattus norvegicus


Alignment Length:303 Identity:88/303 - (29%)
Similarity:131/303 - (43%) Gaps:78/303 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGIILMFQLLHSGCSQFLDPACGIRTQSRTAY------RIINGHTAKYNSSPWMV---FLHSTTD 67
            :||.::..:|  .|:.    .||     ..|:      |::.|..|..||.||.|   :|...|.
  Rat     2 LGITVLAAIL--ACAS----CCG-----NPAFPPNLSTRVVGGEDAVPNSWPWQVSLQYLKDDTW 55

  Fly    68 MFVCGGSLITDKLVLTAAHCFIANQHLVAR--LGEYERTRSEECTGYYCNFREEHMVDAGFKHKL 130
            ...|||||||...|||||||.  |:....|  ||:|..|..:|....|..      ||..:.|:.
  Rat    56 RHTCGGSLITTSHVLTAAHCI--NKDFTYRVGLGKYNLTVEDEEGSVYAE------VDTIYVHEK 112

  Fly   131 YDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLT------ATGWGKTQMESD 189
            ::.....|||||::|::.|...:.|:..|:.         ::..||.      .||||:  :.::
  Rat   113 WNRLFLWNDIAIIKLAEPVELSNTIQVACIP---------EEGSLLPQDYPCYVTGWGR--LWTN 166

  Fly   190 SDALQTLDIRRQP---PDVCAK----FIGQTIAGNQFCAGNWDS--NLCNGDSGGPL------GA 239
            ....:.|....||   ...|::    ||  .:.....|||. |.  :.|||||||||      |:
  Rat   167 GPIAEVLQQGLQPIVSHATCSRLDWWFI--KVRKTMVCAGG-DGVISACNGDSGGPLNCQAEDGS 228

  Fly   240 VITHKNTQRFVQVGIASY-TNRNC---QKASVFTDVLSHAEFI 278
            ...|         ||.|: ::..|   :|..|||.|.::.::|
  Rat   229 WQVH---------GIVSFGSSSGCNVHKKPVVFTRVSAYNDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 80/263 (30%)
Tryp_SPc 45..278 CDD:238113 79/262 (30%)
CtrcNP_001071117.1 Tryp_SPc 29..262 CDD:214473 80/263 (30%)
Tryp_SPc 30..265 CDD:238113 80/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.