DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and thetaTry

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:269 Identity:76/269 - (28%)
Similarity:103/269 - (38%) Gaps:78/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQ--HLVARLGEYERTRS 106
            ||:.|......:.|:.|.|.:.:....||||||.:..|:|||||.:..:  .:..|||.   |..
  Fly    34 RIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGS---TLY 95

  Fly   107 EECTGYYCNFRE-EHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYL 170
            .| .|.....|| .:..|       |:..|...|:.||:|.:.|...:|||              
  Fly    96 NE-GGIVVAVRELAYNED-------YNSKTMEYDVGILKLDEKVKETENIR-------------- 138

  Fly   171 DKIDLLT----------ATGWG-----------KTQMESDSDALQTLDIRRQPPDVCA----KFI 210
             .|:|.|          .||||           ||        ||.:.:.......||    |: 
  Fly   139 -YIELATETPPTGTTAVVTGWGSKCYFWCMTLPKT--------LQEVYVNIVDWKTCASDEYKY- 193

  Fly   211 GQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIAS--YTNRNCQKASVFTDVLS 273
            |:.|..:..||.....:.|.|||||||..    .||    .|||.|  |...:.....|::||.:
  Fly   194 GEIIYDSMVCAYEKKKDACQGDSGGPLAV----GNT----LVGIVSWGYACASNLLPGVYSDVPA 250

  Fly   274 HAEFILRVW 282
                 ||.|
  Fly   251 -----LRKW 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/263 (28%)
Tryp_SPc 45..278 CDD:238113 72/262 (27%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 76/269 (28%)
Tryp_SPc 35..255 CDD:238113 75/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
11.000

Return to query results.
Submit another query.