DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and lambdaTry

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster


Alignment Length:261 Identity:64/261 - (24%)
Similarity:98/261 - (37%) Gaps:48/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IILMFQLLHSGCSQFLDPACGIRTQS----RTAYRIINGHTAKYNSSPWMVFL-----HSTTDMF 69
            |:::|.:|..||| ..||.  .|.:.    :...||:.|........|..:.:     |.     
  Fly     4 ILVVFLVLGVGCS-LADPI--YRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHR----- 60

  Fly    70 VCGGSLITDKLVLTAAHCFIA-----NQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHK 129
             |||::.....:::||||...     |..:||         ......:....::|..|.....|.
  Fly    61 -CGGTIYRSNQIISAAHCVNTLSGPENLTIVA---------GSSNIWFPTGPQQELEVREIIIHP 115

  Fly   130 LYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKT-QMESDSDAL 193
            .|....:..|.|||.|.....:.|.::||.:.     :...|....:|.||||.| :..:.||.|
  Fly   116 KYRTLNNDYDAAILILDGDFEFNDAVQPIELA-----KERPDHDTPVTVTGWGTTSEGGTISDVL 175

  Fly   194 QTLDIRRQPPDVCAKFIGQTIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIAS 256
            |.:.:.......|.......:.....|||  ....:.|.|||||||    .:.||    .:||.|
  Fly   176 QEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPL----VYNNT----LLGIVS 232

  Fly   257 Y 257
            :
  Fly   233 W 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 55/227 (24%)
Tryp_SPc 45..278 CDD:238113 54/226 (24%)
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 55/227 (24%)
Tryp_SPc 36..259 CDD:238113 54/226 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.