DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG12133

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:283 Identity:90/283 - (31%)
Similarity:121/283 - (42%) Gaps:55/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFL--------HSTTDMFVCGGSLITDKLVLTAAHCFI 89
            ||   ||..:..|:.|..|:.|..||.|.|        ...:.|  |.||||..:.|||||||..
  Fly    53 CG---QSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPM--CAGSLIASRYVLTAAHCLN 112

  Fly    90 ANQHLVA--RLGEYERTRSEECTGYYCN----FREEHM---VDAGFKHKLYDPNT--HANDIAIL 143
            .|...||  ||||::.....:.| :..|    :...|:   ||....|:.|....  |.||||:|
  Fly   113 VNDFYVARVRLGEHDTENDPDYT-WLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALL 176

  Fly   144 RLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTAT---------GWGKTQMESDSDALQTLDIR 199
            ||...|.|...|||||:     |    ..|:|.|::         |||.:.::..|..|:...|.
  Fly   177 RLKSRVKYTLQIRPICI-----W----PGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTIS 232

  Fly   200 RQPPDVCAK-----FIGQTIAGNQFCAGNWD-SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYT 258
            ...||.|..     .:.:.|   |.||..|| ::...||||.||.|.:.....|.:...||.||.
  Fly   233 GMSPDECLNRYPTLLVDKDI---QICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYG 294

  Fly   259 NRNCQKA---SVFTDVLSHAEFI 278
            .......   :|:|...|:.|:|
  Fly   295 GGPSSYGYGPAVYTKTSSYYEWI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 85/270 (31%)
Tryp_SPc 45..278 CDD:238113 85/269 (32%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 86/271 (32%)
Tryp_SPc 62..317 CDD:214473 85/269 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463528
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.