DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and TMPRSS9

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001382442.1 Gene:TMPRSS9 / 360200 HGNCID:30079 Length:1093 Species:Homo sapiens


Alignment Length:300 Identity:84/300 - (28%)
Similarity:126/300 - (42%) Gaps:33/300 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSQFLDPA---CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAH 86
            ||...|.|   ||::...|.|.||:.|..|.....||...|....:.| ||.::|..:.:::|||
Human   214 CSDGSDEAHCECGLQPAWRMAGRIVGGMEASPGEFPWQASLRENKEHF-CGAAIINARWLVSAAH 277

  Fly    87 CFIANQ---HLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKS 148
            ||...|   ..||.:|....:.||..|       ....|....||.||:.:|...|:|:|.|:..
Human   278 CFNEFQDPTKWVAYVGATYLSGSEAST-------VRAQVVQIVKHPLYNADTADFDVAVLELTSP 335

  Fly   149 VVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWG--KTQMESDSDALQTLDIRRQPPDVCAKFIG 211
            :.:..:|:|:|:   ....|..........:|||  |.......:.||...:......:||...|
Human   336 LPFGRHIQPVCL---PAATHIFPPSKKCLISGWGYLKEDFLVKPEVLQKATVELLDQALCASLYG 397

  Fly   212 QTIAGNQFCAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA---SVFTDV 271
            .::.....|||..|..:  |.|||||||   :..:.:.||...||.|: ...|.:|   .|:..|
Human   398 HSLTDRMVCAGYLDGKVDSCQGDSGGPL---VCEEPSGRFFLAGIVSW-GIGCAEARRPGVYARV 458

  Fly   272 LSHAEFILRVWRMYGKGQTLPI-PKKPPTTTRPPTWWHTT 310
            ....::||.....    .::|: |...|....|.|.|.|:
Human   459 TRLRDWILEATTK----ASMPLAPTMAPAPAAPSTAWPTS 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/243 (28%)
Tryp_SPc 45..278 CDD:238113 66/242 (27%)
TMPRSS9NP_001382442.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.