DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG1773

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster


Alignment Length:274 Identity:91/274 - (33%)
Similarity:134/274 - (48%) Gaps:32/274 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QFLDPACGIRTQ----SRTAYRIINGHTAKYNSSPWMVFLHSTTD--MFVCGGSLITDKLVLTAA 85
            |.....||:.:.    .|...||..|..:...|.|||.|||.:.|  |..|||||:::..|||||
  Fly    40 QLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAA 104

  Fly    86 HCF---IANQHLVARLGEYERTRSEECTGYYCNFR-------EEHMVDAGFKHKLYDPNTHANDI 140
            |||   ..::.:...|||.:.:.:.:|..|  |::       ||..:|....|:.::......||
  Fly   105 HCFKMCPRSKEIRVWLGELDISSTSDCVTY--NYQRVCALPVEEFTIDKWILHEEFNLFYPGYDI 167

  Fly   141 AILRLSKSVVYRDNIRPICV-VWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPD 204
            |:::|:|.||::|:|||||: :.|......|.......|.|||:|  ||...|..|:::... .:
  Fly   168 ALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRT--ESRRFANSTMEVHIN-TE 229

  Fly   205 VCAKFIGQTIAGNQFCAGNWD-SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKA 265
            .|..  |:   ...|...|.| .:.|.|||||||....|.....|.||.|:.|..::||   |||
  Fly   230 KCTD--GR---DTSFLCANGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQKA 289

  Fly   266 SVFTDVLSHAEFIL 279
             .:.||.::..:||
  Fly   290 -YYMDVPTYVPWIL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 85/250 (34%)
Tryp_SPc 45..278 CDD:238113 84/249 (34%)
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 85/250 (34%)
Tryp_SPc 62..301 CDD:238113 84/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.