DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG8738

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:276 Identity:77/276 - (27%)
Similarity:118/276 - (42%) Gaps:36/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FLDPACGIRTQSRTAYRI--INGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFI- 89
            ||...||........|::  .|...:.:...||||.|......|||||:||..:||||:||... 
  Fly   183 FLLKGCGYSNPKGLYYQLDGYNNGESVFAEFPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFN 247

  Fly    90 -ANQHLVARLGEYERTRSEECTGYYCN-FREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYR 152
             :...|:.|.|:::.....|...|... ..|.|      :|:.::..|..||||::.|.:.....
  Fly   248 RSEDSLLVRAGDWDLNSQTELHPYQMRAISELH------RHENFNNLTLYNDIALVVLERPFQVA 306

  Fly   153 DNIRPICVVWDH--RWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDV----CAKFIG 211
            .:|:|||:....  :....|.....| |||||...  |.|..::.|..|.:.|.|    |.:.:.
  Fly   307 PHIQPICLPPPETPQMEAELRSASCL-ATGWGLRY--STSRTMENLLKRIELPAVDHESCQRLLR 368

  Fly   212 QTIAGNQF-------CAGN-WDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQK--AS 266
            .|:.|.::       |||. ...:.|.||.|.||...:..:. .|:..||:.|:.....:|  .:
  Fly   369 HTVLGRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFCTLPGQK-DRYQLVGLVSWGIECAEKDVPA 432

  Fly   267 VFTDVLSHAEFILRVW 282
            .:|:|.     .||.|
  Fly   433 AYTNVA-----YLRNW 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/254 (27%)
Tryp_SPc 45..278 CDD:238113 69/253 (27%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 71/252 (28%)
Tryp_SPc 207..444 CDD:214473 71/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.