DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Jon44E

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:261 Identity:73/261 - (27%)
Similarity:108/261 - (41%) Gaps:63/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEE 108
            ||.||:.|.....|::|.|......:.||||:|....|||||||..:..|::...|         
  Fly    40 RITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVLIYFG--------- 95

  Fly   109 CTGYYCNFREE----HMVDAGFKHKLYDPNTHA-NDIAILRLSKSVVYRDNIRPICVVWDHRWRH 168
                 .:||.|    |.|......:..|.|... ||||::|:           |....|.     
  Fly    96 -----ASFRHEAQYTHWVSRSDMIQHPDWNDFLNNDIALIRI-----------PHVDFWS----- 139

  Fly   169 YLDKIDL--------------LTATGWGKTQMESD-SDALQTLDIRRQPPDVCAKFIGQT-IAGN 217
            .::|::|              ..|:|||.|...|. |:.|..:|::....:.|..:.|.. |..|
  Fly   140 LVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNYITDN 204

  Fly   218 QFCAGNWD--SNLCNGDSGGPLGAVITHKNTQRFVQVGIASY-TNRNCQ--KASVFTDVLSHAEF 277
            ..|. |.|  .:.|:|||||||   :.|.|.:   .|||.|: :...|.  :.:.||.|..:.::
  Fly   205 TICI-NTDGGKSSCSGDSGGPL---VLHDNNR---IVGIVSFGSGEGCTAGRPAGFTRVTGYLDW 262

  Fly   278 I 278
            |
  Fly   263 I 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 72/259 (28%)
Tryp_SPc 45..278 CDD:238113 71/258 (28%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 72/259 (28%)
Tryp_SPc 41..266 CDD:238113 72/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435670
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.