DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG14760

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster


Alignment Length:237 Identity:58/237 - (24%)
Similarity:98/237 - (41%) Gaps:54/237 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CGGSLITDKLVLTAAHCFIANQ-HLVARL----GEYERTRSEECTGYYCNFREEHMVDAGFKHKL 130
            ||.::|..:.:|:|||||:..: :..|:|    ||::...|.|...     .:.:.:||...|:.
  Fly   304 CGAAIIHHRYLLSAAHCFLGPETNSAAKLRVVVGEHDLASSFETFA-----TQRYDLDALILHED 363

  Fly   131 YD--PNTHANDIAILRLSKSVVYRDNIRPICV------------VWDHRWRHYLDKIDLLTATGW 181
            :.  .....||||:|:...::|:..::.|.|:            :..|:          :.|.||
  Fly   364 FSQASGQPKNDIAMLKTRMAIVWSQHVGPACLPLQPGEDGQKLPLAGHQ----------VVAAGW 418

  Fly   182 GKTQMESDSD------ALQTLDIRRQPPDVCAKFIGQT--IAGNQFCAGNWDSNLCNGDSGGPLG 238
            |.|.......      .|..:|.||     |.:.:...  :..:.||......:.|..||||.| 
  Fly   419 GTTSYGGPQTHRLLKATLDVIDGRR-----CRQALSSAGGLPPHTFCTYTPGRDTCQYDSGGAL- 477

  Fly   239 AVITHKNTQRFVQVGIASYTNRNC--QKASVFTDVLSHAEFI 278
               ..:...|.:.|||.|: .:.|  |:.||.|.|.|..::|
  Fly   478 ---YERINGRLMAVGIVSF-GQACAAQQPSVNTRVASFIKWI 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 57/235 (24%)
Tryp_SPc 45..278 CDD:238113 57/235 (24%)
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 58/237 (24%)
Tryp_SPc 281..515 CDD:214473 57/235 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.