DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and try-9

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:264 Identity:56/264 - (21%)
Similarity:91/264 - (34%) Gaps:82/264 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GSLITDKLVLTAAH-----------CFIANQHLVARLGEYER---------TRSEECTGYYCNFR 117
            |:|::...::||||           |...|......:.:|:.         ...|.|.|.:   |
 Worm    30 GTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYFVRDYKNFVAFVNVTCAVPEMCKGLH---R 91

  Fly   118 EEHMVDAGFKHKLYDPNTHA----------NDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDK 172
            ::.......| .||....:.          ||||:..|.:.:.:..:|.|.|:       ....|
 Worm    92 KDMFKPLAIK-SLYIRKGYVGDGCIDRESFNDIAVFELEEPIEFSKDIFPACL-------PSAPK 148

  Fly   173 IDLLTAT-----GWGKTQMES--DSDALQTLDIRRQPPDVCAKFIGQTI----AGNQFCAGNWDS 226
            |..:..|     |:|:...:|  :|..|::|          ..|:.:..    .|..:|....:.
 Worm   149 IPRIRETGYKLFGYGRDPSDSVLESGKLKSL----------YSFVAECSDDFPYGGVYCTSAVNR 203

  Fly   227 NL-CNGDSGGPLGAVITHKNTQRFVQVGIAS--------YTNRN---------CQKASVFTDVLS 273
            .| |:||||.  |.|.|.......|.||:.|        |...|         .|:..:..||.:
 Worm   204 GLSCDGDSGS--GVVRTSDTRNVQVLVGVLSAGMPCPELYDTHNRQRQQRRQLTQETDLLVDVSA 266

  Fly   274 HAEF 277
            |.:|
 Worm   267 HVDF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 56/264 (21%)
Tryp_SPc 45..278 CDD:238113 56/264 (21%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 49/229 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.