DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and scaf

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:253 Identity:60/253 - (23%)
Similarity:105/253 - (41%) Gaps:42/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FLDP-------ACGIRTQSRTAYRIINGHTAKYNSSPWM-VFLHSTTDMFVCGGSLITDKLVLTA 84
            ::||       .|..|.: ||....:....|.:...||. :.|..::...:|||::|.|:.||::
  Fly   400 YVDPWPVNLAGVCATRNK-RTKPTGVKDLDANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSS 463

  Fly    85 AHCF--IANQHLVARLGEYERTRSEE-----CTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAI 142
            |.|.  :....:..:.||:|...:.|     .||.       ..||.   |..|||:|:::|:||
  Fly   464 ASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLTGV-------KTVDV---HPDYDPSTNSHDLAI 518

  Fly   143 LRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGK--TQMESDSDALQTLDIRRQPPDV 205
            :||.:.:.:..:|:|||:..:..    .|.....| :||||  ..:..:...:...|...|....
  Fly   519 IRLERRLEFASHIQPICISDEDP----KDSEQCFT-SGWGKQALSIHEEGALMHVTDTLPQARSE 578

  Fly   206 CAKFIGQTIAGNQFCAGNWD---SNLCNGDSGGPLGAVITHKN------TQRFVQVGI 254
            |:.......:..:|.:..:|   :..|...|...|..:...:|      |.||.:..|
  Fly   579 CSADSSSVCSATKFDSCQFDVGSALACGSGSSVRLKGIFAGENSCGEGQTVRFAKPDI 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 54/230 (23%)
Tryp_SPc 45..278 CDD:238113 54/229 (24%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 49/202 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435499
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.