DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG17572

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:258 Identity:76/258 - (29%)
Similarity:116/258 - (44%) Gaps:31/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IINGHTAK-YNSSPWMV---FLHSTTDMFV--CGGSLITDKLVLTAAHCFI--ANQHLVA--RLG 99
            ::.||..| ..|.|::.   |.|..|..|.  |.|::|..:::||||||.:  |:.|.::  |:|
  Fly   128 LVQGHFYKGLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSSVRVG 192

  Fly   100 EYERTRSEEC--TGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVW 162
            ||:.:...:|  ||:.......|.:.....|..|....:.:|||:|.|...:.|....:|||:  
  Fly   193 EYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQPICL-- 255

  Fly   163 DHRWRHYLDKIDLLTATGWGKTQMES-DSDALQTLDIRRQPPDVCAKFIGQT--------IAGNQ 218
             .:.|..|......|..||||....| ....:..||:.....|:|.:..|.|        |.|..
  Fly   256 -QKTRANLVVGKRATIAGWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQW 319

  Fly   219 FCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDVLSHAEFI 278
            .|||....::|.|..|.||..    :....|.|:||.|:.:.||   :..||:|.|...:|:|
  Fly   320 MCAGGEGKDVCQGFGGAPLFI----QENGIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 75/256 (29%)
Tryp_SPc 45..278 CDD:238113 75/256 (29%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 73/248 (29%)
Tryp_SPc 138..378 CDD:214473 72/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.