DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG18477

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster


Alignment Length:350 Identity:93/350 - (26%)
Similarity:145/350 - (41%) Gaps:87/350 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPACG-IRTQSRT-AYRIINGHTAKYNSSPWMV-FLHSTTDMFVCGGSLITDKLVLTA---AHCF 88
            ||.|| :.::..| ::|..:...|:....|||| .|.:.|..:|.||:||...:|:||   ....
  Fly    90 DPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENM 154

  Fly    89 IANQHLVARLGEYE-RTRSEECTGYYCNFREEHMVDAGF----KHKLYDPNTHANDIAILRLSKS 148
            .|:| ||.|.||:: .|::|:...          ||...    :|..::....||::|::.|.:|
  Fly   155 TASQ-LVVRAGEWDFSTKTEQLPS----------VDVPIRSIVRHPGFNLENGANNVALVFLRRS 208

  Fly   149 VVYRDNIRPICVV-----WDHRWRHYLDKIDLLTATGWGKTQMESDS--DALQTLDIRRQPPDVC 206
            :....:|.|||:.     :|         ......|||||...:..|  :.|:.:.:    |.|.
  Fly   209 LTSSRHINPICMPSAPKNFD---------FSRCIFTGWGKNSFDDPSYMNVLKKISL----PVVQ 260

  Fly   207 AKFIGQTIA---GNQF-------CAG---NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYT 258
            .:...|.:.   ||.|       |||   ..||  |.||.|.||...| ..|.||:...||.:: 
  Fly   261 RRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDS--CEGDGGSPLACAI-KDNPQRYELAGIVNF- 321

  Fly   259 NRNC---QKASVFTDVLSHAEFI-LRVWRMYGKGQTLPIPKKPPTTTRPPTWWHTTRIPKQTFQD 319
            ..:|   ...:|:|:|.:..|:| |....|....:...:|...||.:..|               
  Fly   322 GVDCGLPGVPAVYTNVANVIEWITLTTVNMPLPEEREEVPYASPTLSAGP--------------- 371

  Fly   320 YDYDTNHGSHWDW-NYSPEWYPGGY 343
                  :.:.|:. ||  ||.|.||
  Fly   372 ------YLNQWNQPNY--EWLPTGY 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/265 (28%)
Tryp_SPc 45..278 CDD:238113 72/264 (27%)
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 72/258 (28%)
Tryp_SPc 113..344 CDD:238113 72/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.