DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG4650

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:306 Identity:139/306 - (45%)
Similarity:184/306 - (60%) Gaps:31/306 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTALIGVPTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHST 65
            |.:.:||:..     |:|.|...|.||:||..||:.|         ||..|...|||||.:||::
  Fly     1 MDSVVIGISA-----LLFLLPVPGSSQYLDGRCGLLT---------NGKIANNISSPWMAYLHTS 51

  Fly    66 TDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKL 130
            ..::||||::||:|||||||||..|::.||||:||:..|.....|     ...|:.|...|.|.|
  Fly    52 ELLYVCGGTVITEKLVLTAAHCTRASEQLVARIGEFIGTDDANDT-----MLSEYQVSQTFIHSL 111

  Fly   131 YDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQT 195
            |:..|.|||||||.|:..:|:...|||||:||...||.|:|.|.:|:...||.....::|||.:.
  Fly   112 YNTTTSANDIAILGLATDIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAFRI 176

  Fly   196 LDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNR 260
            .||||||.::|:...|..|..:|||||:.||.|||.|...||||:||.||.||:|.:|||: ||:
  Fly   177 TDIRRQPANMCSTLNGTAILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIAT-TNQ 240

  Fly   261 NCQKASVFTDVLSHAEFILRVWRMYGKGQTLPIPKKPPTTTRPPTW 306
            .|::|||:||||||.:|||.|||.|..|:           ..|.||
  Fly   241 KCKRASVYTDVLSHTDFILSVWRQYRNGE-----------KSPKTW 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 114/233 (49%)
Tryp_SPc 45..278 CDD:238113 114/232 (49%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 114/230 (50%)
Tryp_SPc 33..258 CDD:304450 114/230 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463258
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.