DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and PRSS48

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:282 Identity:82/282 - (29%)
Similarity:118/282 - (41%) Gaps:66/282 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCF---IA 90
            |...||   |...:.|::.|..|.....||.|.||...: |:|||||::::|:||||||.   ..
Human    38 LSLVCG---QPVYSSRVVGGQDAAAGRWPWQVSLHFDHN-FICGGSLVSERLILTAAHCIQPTWT 98

  Fly    91 NQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNI 155
            .......||......|.:...||        |.....|..|...|  .|:|:|:||..|.:...|
Human    99 TFSYTVWLGSITVGDSRKRVKYY--------VSKIVIHPKYQDTT--ADVALLKLSSQVTFTSAI 153

  Fly   156 RPICV------------VWDHRWRHYLDKIDLLTATGWGKTQMESDSD---ALQTLD---IRRQ- 201
            .|||:            .|               .|||||.:..||.|   |||..:   |.|| 
Human   154 LPICLPSVTKQLAIPPFCW---------------VTGWGKVKESSDRDYHSALQEAEVPIIDRQA 203

  Fly   202 ------PPDVCAKFIGQTIAGNQFCAGNWDS--NLCNGDSGGPLGAVITHKNTQRFVQVGIASYT 258
                  |..:....:...|..::.|||:..:  :.|.|||||||...|...    ::|.|:.|: 
Human   204 CEQLYNPIGIFLPALEPVIKEDKICAGDTQNMKDSCKGDSGGPLSCHIDGV----WIQTGVVSW- 263

  Fly   259 NRNCQKA--SVFTDVLSHAEFI 278
            ...|.|:  .|:|:|:.:.::|
Human   264 GLECGKSLPGVYTNVIYYQKWI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 77/265 (29%)
Tryp_SPc 45..278 CDD:238113 76/264 (29%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 77/265 (29%)
Tryp_SPc 51..288 CDD:238113 77/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.