DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG5390

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:306 Identity:78/306 - (25%)
Similarity:126/306 - (41%) Gaps:62/306 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSQFLD---------------------PACGIRTQSRTAYRIIN--GHTAKYNSSPWMVFL---H 63
            |..:||                     ..||.:..:...::|..  ...|::...|||:.:   .
  Fly   106 CKNYLDLCCDLPNKRKDPIFEFKPDHPEGCGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREE 170

  Fly    64 STTDMFVCGGSLITDKLVLTAAHCFIANQ--HLVARLGEYERTRSEECTGYYCNFREEHMVDAGF 126
            ...:::.|||:||...:|||||||....|  .:|.|.||::.....|...:     |:..|....
  Fly   171 GNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRH-----EDRYVKEII 230

  Fly   127 KHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDL--LTATGWGKTQMESD 189
            .|:.::..:..||:|::.|......::||:.:|:      .:..||.|.  ..||||||.:...|
  Fly   231 YHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCL------PNVGDKFDFDRCYATGWGKNKFGKD 289

  Fly   190 SD---ALQTLDIRRQPPDVCAKFIGQTIAGNQF-------CA-GNWDSNLCNGDSGGPLGAVIT- 242
            .:   .|:.:|:...|...|...:.:|..|..|       || |..|.:.|.||.|.||...|. 
  Fly   290 GEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAG 354

  Fly   243 HKNTQRFVQVGIASYTNRNCQKAS---VFTDVLSHAEFI---LRVW 282
            .||  ||...||.:: ...|.:.:   |:..|.....:|   |::|
  Fly   355 QKN--RFKSAGIVAW-GIGCGEVNIPGVYASVAKLRPWIDAKLKIW 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 70/257 (27%)
Tryp_SPc 45..278 CDD:238113 70/256 (27%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 69/251 (27%)
Tryp_SPc 153..390 CDD:214473 69/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.