DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and PRSS38

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:326 Identity:81/326 - (24%)
Similarity:141/326 - (43%) Gaps:55/326 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PTFVGIILMF---------QLLH-----SGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWM 59
            |:.:|::|:.         .|:|     .|.|.....|||   :.....:|:.|..|.....||.
Human    13 PSALGLLLLLLVVAPPRVAALVHRQPENQGISLTGSVACG---RPSMEGKILGGVPAPERKWPWQ 74

  Fly    60 VFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDA 124
            |.:| ...:.|||||::.:..||:|||||..::: :.....|....:....|.:..:.|.:.|..
Human    75 VSVH-YAGLHVCGGSILNEYWVLSAAHCFHRDKN-IKIYDMYVGLVNLRVAGNHTQWYEVNRVIL 137

  Fly   125 GFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLT----ATGWGKTQ 185
            ...:::|.|  ...|:|:::|...:|:.:::.|:|:.        ..:::|.:    |||||...
Human   138 HPTYEMYHP--IGGDVALVQLKTRIVFSESVLPVCLA--------TPEVNLTSANCWATGWGLVS 192

  Fly   186 MESD-SDALQTLDIRRQPPDVCAKFIGQT--IAGNQFCAGNW--DSNLCNGDSGGPLGAVITHKN 245
            .:.: ||.||.:.:.......|....|..  |..:..|||:.  ...:|.|||||||   :...|
Human   193 KQGETSDELQEMQLPLILEPWCHLLYGHMSYIMPDMLCAGDILNAKTVCEGDSGGPL---VCEFN 254

  Fly   246 TQRFVQVGIASYTNRNCQK---ASVFTDVLSHAEFILRVWRMYGKGQTLPIPKKPPTTTRP---P 304
             :.::|:||.|: .|.|..   ..|:..|...:::|.      ...:..|.|.:|.....|   |
Human   255 -RSWLQIGIVSW-GRGCSNPLYPGVYASVSYFSKWIC------DNIEITPTPAQPAPALSPALGP 311

  Fly   305 T 305
            |
Human   312 T 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 64/245 (26%)
Tryp_SPc 45..278 CDD:238113 64/244 (26%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 65/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.