DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Jon25Bii

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster


Alignment Length:262 Identity:70/262 - (26%)
Similarity:105/262 - (40%) Gaps:62/262 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDM--FVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRS 106
            ||.||:.|.....|::|.|..::|.  :.||||:|....|:|||||......:....|...|.::
  Fly    42 RITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRLQA 106

  Fly   107 EECTGYYCNFREEHMVDAGF--KHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHY 169
            :          ..|.|.:|.  :|..|:.|...|||:::.           .|....|     |.
  Fly   107 Q----------YTHTVGSGHFRQHSDYNTNNLNNDISLIN-----------TPHVDFW-----HL 145

  Fly   170 LDKIDL--------------LTATGWGKTQMESD----SDALQTLDIRRQPPDVCAKFIG-QTIA 215
            ::|::|              ..|:|||:   ..|    ||.|..:|.:....|.|:...| ..|.
  Fly   146 INKVELPDGNERHDSFAGWWALASGWGR---PCDSCGVSDYLNCVDSQIITRDECSSVYGTDVIT 207

  Fly   216 GNQFCAGN-WDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRN-CQKA--SVFTDVLSHAE 276
            .|..|... ...:.|.|||||||   :.|   .|...||:.|:...: |...  ..||.|.|:.:
  Fly   208 DNVICTSTPGGKSTCAGDSGGPL---VLH---DRSKLVGVTSFVAASGCTSGLPDGFTRVTSYLD 266

  Fly   277 FI 278
            :|
  Fly   267 WI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/260 (27%)
Tryp_SPc 45..278 CDD:238113 68/259 (26%)
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 69/260 (27%)
Tryp_SPc 43..271 CDD:238113 69/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435703
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.