DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG3117

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:299 Identity:82/299 - (27%)
Similarity:129/299 - (43%) Gaps:62/299 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PACGIRTQSRTAY-------RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCF 88
            |...:.|..||:|       ..:.|...|.|..||:..|.: ...::.||||||..|||||||..
  Fly    71 PQHSVDTLLRTSYPNALDGSPQVFGDQTKPNQFPWVTALFA-KGSYLGGGSLITPGLVLTAAHIL 134

  Fly    89 --IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVY 151
              ::...::.|.||::.:.||:     .|...:..|....:|:.::.::.|||:|:|.|......
  Fly   135 AGLSPNDIMVRAGEWDLSSSEK-----LNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFEL 194

  Fly   152 RDNIRPICV-----VWDHRWRHYLDKIDLLTATGWGKTQMESDSDA-LQTLDIRRQPPDV----C 206
            |.||:.|.:     .:|.|         :.|..|||   |.|.:|. :||:..:...|.|    |
  Fly   195 RANIQTIRLPIPDKTFDRR---------ICTVAGWG---MRSSTDVDIQTIQQKVDLPVVESSKC 247

  Fly   207 AKFIGQTIAGNQF-------CAGNWDS-NLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQ 263
            .:.:..|..|:.:       |||..:. ::|:...|..|...: ..:..|:.|.||.|: ...|.
  Fly   248 QRQLRLTKMGSNYQLPASLMCAGGEEGRDVCSLFGGFALFCSL-DDDPNRYEQAGIVSF-GVGCG 310

  Fly   264 KASV---FTDVLS-------HAEFILRVWRMYGKGQTLP 292
            :|:|   ||.|..       |.|.:|.|     .|..||
  Fly   311 QANVPTTFTHVSKFMEWINPHLEQVLSV-----PGNMLP 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 72/263 (27%)
Tryp_SPc 45..278 CDD:238113 72/262 (27%)
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 70/253 (28%)
Tryp_SPc 95..328 CDD:214473 70/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.