DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and ela2l

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_956180.1 Gene:ela2l / 334304 ZFINID:ZDB-GENE-040511-1 Length:267 Species:Danio rerio


Alignment Length:279 Identity:82/279 - (29%)
Similarity:129/279 - (46%) Gaps:52/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ACGIRTQSRTAYRIINGHTAKYNSSPWMVFLH--STTDMF-VCGGSLITDKLVLTAAHCFIANQH 93
            :||:.|......|::.|...:.||.||.:.|.  |.::.: .||||||..:.|||||||..:::.
Zfish    16 SCGLPTFPPIVTRVVGGVDVRPNSWPWQISLQYKSGSNWYHTCGGSLIDKQWVLTAAHCISSSRT 80

  Fly    94 LVARLGEYERTRSEECTGYYCNFREEHMVDAG--FKHKLYDPNTHANDIAILRLSKSVVYRDNIR 156
            ....||::  :.|:|..|...       :.||  ..|:.::..|..||||:::|..:|...|.|.
Zfish    81 YRVFLGKH--SLSQEENGSVA-------IGAGKIIVHEAWNSFTIRNDIALIKLETAVTIGDTIT 136

  Fly   157 PICV-----VWDHRWRHYLDKIDLLTATGWGKTQMESD-SDALQTLDIRRQPPDVCAK--FIGQT 213
            |.|:     |..|....|:        ||||:...... :|.||...:.......|:|  :.|..
Zfish   137 PACLPEAGYVLPHNAPCYV--------TGWGRLYTNGPLADILQQALLPVVDHATCSKSDWWGSQ 193

  Fly   214 IAGNQFCAGNWDSNL--CNGDSGGPL------GAVITHKNTQRFVQVGIASY-TNRNC---QKAS 266
            :..:..|||. |..:  |:|||||||      ||...|         ||.|: :..:|   :|.:
Zfish   194 VTTSMVCAGG-DGVVAGCDGDSGGPLNCAGSDGAWEVH---------GIVSFGSGLSCNYNKKPT 248

  Fly   267 VFTDVLSHAEFILRVWRMY 285
            |||.|.:::::|.:....|
Zfish   249 VFTRVSAYSDWISKNMASY 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 77/258 (30%)
Tryp_SPc 45..278 CDD:238113 76/257 (30%)
ela2lNP_956180.1 Tryp_SPc 28..260 CDD:214473 77/258 (30%)
Tryp_SPc 29..263 CDD:238113 77/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.