DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG14227

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:290 Identity:78/290 - (26%)
Similarity:125/290 - (43%) Gaps:45/290 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IILMFQLL----HSGCSQFLDPACG--IRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCG 72
            ::::|..|    ..|.:..||..||  :.|.::..:......:....::||:|.: .......|.
  Fly     8 LLILFASLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSV-IVNGKAKCS 71

  Fly    73 GSLITDKLVLTAAHCFIANQHLVARLGEYER-TRSEEC------TGYYCNFREEHMVDAGFKHKL 130
            ||||..:.||||||| :..:.:...||:::. ...:.|      :..||...::.:|.||| .|:
  Fly    72 GSLINHRFVLTAAHC-VFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGF-GKI 134

  Fly   131 YDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQT 195
               .....||.:||:..:|.|.|.:||||::.:..    :..||....|.||.|          .
  Fly   135 ---QAQQYDIGLLRMQHAVQYSDFVRPICLLINEP----VAAIDRFQLTVWGTT----------A 182

  Fly   196 LDIRRQP------------PDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQR 248
            .|.|..|            .::|.....|.:..:|.|.....|:.|.||||||..|.|.:..|.|
  Fly   183 EDFRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGGTYR 247

  Fly   249 FVQVGIASYTNRNCQKASVFTDVLSHAEFI 278
            ..|.||..:...:|...||.|:|..:.::|
  Fly   248 TFQFGIIIFGLSSCAGLSVCTNVTFYMDWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/252 (27%)
Tryp_SPc 45..278 CDD:238113 69/251 (27%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 69/239 (29%)
Tryp_SPc 57..277 CDD:238113 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.