DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP008276

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_555189.1 Gene:AgaP_AGAP008276 / 3291691 VectorBaseID:AGAP008276 Length:272 Species:Anopheles gambiae


Alignment Length:261 Identity:64/261 - (24%)
Similarity:100/261 - (38%) Gaps:66/261 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHC---FIANQHLVA--RLGEYERT 104
            |:.|........|:...: .|.....||||:|..:.||||.||   .:.|.:.||  ....||..
Mosquito    39 IVGGMKVDIEQVPYQAAI-LTLGQVHCGGSIIGPRWVLTAYHCVDWLLPNFYEVAVGSTNPYEGQ 102

  Fly   105 RSEECTGYYCNFREEHMVDAGF--KHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWR 167
            |.              :|...|  ...|.|||.   |||:.:|:.::.|...::  |        
Mosquito   103 RI--------------LVQELFVPLETLSDPNF---DIALAKLAHTLQYSSTVQ--C-------- 140

  Fly   168 HYLDKIDLLTA------------TGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFC 220
                 |.|||:            :|:|.|:..:..:.|:...|:..|.|.|.:.....:.....|
Mosquito   141 -----IPLLTSDSSLIPDTPAYISGFGYTKERASDNILKAAQIKVLPWDYCQQAYPYLMREFMLC 200

  Fly   221 AGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQK---ASVFTDVLSHAEFILR 280
            ||..:..:  |.|||||||  ::..|      ..|:..| ...|.:   ..|:..|...:::|:.
Mosquito   201 AGFKEGKVDSCQGDSGGPL--IVNAK------LAGVVFY-GEGCARPHFPGVYISVPWFSDWIIE 256

  Fly   281 V 281
            |
Mosquito   257 V 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 62/256 (24%)
Tryp_SPc 45..278 CDD:238113 62/256 (24%)
AgaP_AGAP008276XP_555189.1 Tryp_SPc 39..257 CDD:238113 63/259 (24%)
Tryp_SPc 39..254 CDD:214473 62/256 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.