DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CLIPE6

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_552458.3 Gene:CLIPE6 / 3291431 VectorBaseID:AGAP011785 Length:374 Species:Anopheles gambiae


Alignment Length:279 Identity:71/279 - (25%)
Similarity:107/279 - (38%) Gaps:72/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLH------STTDMFV-CGGSLITDKLVLTAAHC 87
            |..||.|::.||              .||||.::      .|..:|. ||.|||...:.||.|||
Mosquito   105 DATCGFRSRKRT--------------FPWMVIVYREELDDPTNQLFYQCGASLIAPNVALTVAHC 155

  Fly    88 FI--ANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVV 150
            .:  ..:.||.|.||: |..:|     :.|.|...::    ..|..:.::.|||:|::.||:...
Mosquito   156 VLDQPKERLVIRAGEW-RLETE-----HQNRRVAQLI----TRKASNVHSLANDVALIVLSEPFQ 210

  Fly   151 YRDNIRPIC---------------VVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRR 200
            ..:.|:|||               |.||.  ....|...:|....||:..:              
Mosquito   211 LTETIQPICLPPKGTSFDRSDCFTVGWDR--IIVCDGYAMLVKRIWGEQAV-------------- 259

  Fly   201 QPPDVCAKFIGQTIAGNQF-CAGN-WDSNLCNGDSGG-PLGAVITHKNTQRFVQVGIASYTNRNC 262
            .|.|||...:........| |||. ...::|..:|.| ||...|. .:...:.|.||.:..| .|
Mosquito   260 VPHDVCPHVLPPMRPVQPFLCAGGVITQDMCPRNSTGFPLVCPIP-GSPHHYYQAGIVAMPN-GC 322

  Fly   263 Q---KASVFTDVLSHAEFI 278
            .   ...:|..|..:.::|
Mosquito   323 DDNGAPGIFVQVAHYRDWI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 64/263 (24%)
Tryp_SPc 45..278 CDD:238113 64/262 (24%)
CLIPE6XP_552458.3 Tryp_SPc 109..344 CDD:238113 69/275 (25%)
Tryp_SPc 109..341 CDD:214473 68/273 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.