DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP003627

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_562493.4 Gene:AgaP_AGAP003627 / 3290876 VectorBaseID:AGAP003627 Length:310 Species:Anopheles gambiae


Alignment Length:272 Identity:82/272 - (30%)
Similarity:125/272 - (45%) Gaps:50/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SRTAYRIINGHTAKYNSSPWMVFL-HSTTD-----MFVCGGSLITDKLVLTAAHCFIANQHLVAR 97
            |.....|:.|..|||...|....| :...|     .|:|||:||:::.:|||||||.....::.|
Mosquito    56 SNVVQLIVGGEQAKYGEFPHHALLGYPKKDGEKGYDFLCGGTLISNQHILTAAHCFNEGDPVIVR 120

  Fly    98 LGEYERTRSEECTGYYCNFREEHMVD--AGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICV 160
            :|||: |:||.        .||:..|  :..:|:.|......:|||:::|...::...:|||.| 
Mosquito   121 VGEYD-TKSES--------NEEYESDILSIRRHQDYLSTRSYHDIALVKLKYPIILSKHIRPAC- 175

  Fly   161 VWDHRWRHYLDKIDLLTATGWGKTQ----------MESDSDALQTLDIRR----QPPDVCAKFIG 211
            :||...|:    |....|||:|..:          |:.:.|.....|.:|    .|     || .
Mosquito   176 LWDTEERN----ITRYIATGFGYNETFGTTLSTVMMKVNLDEFPVSDCKRSFKSHP-----KF-R 230

  Fly   212 QTIAGNQFCAGN--WDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDV 271
            |.:...|.|.|:  ...:.|.||||||| .|:|:..:..|..|||.| ....|   ...:::|.|
Mosquito   231 QGVRDGQLCVGSIVEGRDTCQGDSGGPL-QVVTNPRSCSFAVVGITS-IGGVCGGPNAKAIYTKV 293

  Fly   272 LSHAEFI-LRVW 282
            ..:.::| ..||
Mosquito   294 SHYIDWIENNVW 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 78/260 (30%)
Tryp_SPc 45..278 CDD:238113 78/259 (30%)
AgaP_AGAP003627XP_562493.4 Tryp_SPc 62..303 CDD:238113 79/262 (30%)
Tryp_SPc 62..300 CDD:214473 78/259 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.