DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and AgaP_AGAP005304

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_560320.2 Gene:AgaP_AGAP005304 / 3289940 VectorBaseID:AGAP005304 Length:501 Species:Anopheles gambiae


Alignment Length:171 Identity:42/171 - (24%)
Similarity:70/171 - (40%) Gaps:21/171 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GHTAKYNSSPWMVFLHSTTDMFVCGGSLIT---DKLVLTAAHCF-IANQHLVARLGEYERTRSEE 108
            |.::....:||...::.....|..|..|:|   :...:..|.|| .::...:...|.:.:....|
Mosquito   239 GESSPSYLTPWTGGVYYDKLEFEGGTGLVTLINEWYAVGPASCFDNSSAQFIIVFGFFGKAIEIE 303

  Fly   109 C----TGYYCNFREEHM-VDAGFKHKLYDPNTHANDIAILRLSKSV-VYRDNIRPICVVWDHRWR 167
            |    ....||...:.: |...|.|.||: .|..:|||:::|:..| ..|.|::|||:......|
Mosquito   304 CDMTNNTELCNVPPQSVTVQKVFNHPLYN-GTRNHDIALVKLATRVDTSRPNVKPICLPITDAIR 367

  Fly   168 HYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAK 208
            .| |..:|:         |...|..|..:|.|....:.|.|
Mosquito   368 SY-DVSNLV---------MRKSSFELTKVDDRYVDTEECQK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 42/171 (25%)
Tryp_SPc 45..278 CDD:238113 42/171 (25%)
AgaP_AGAP005304XP_560320.2 Tryp_SPc <12..>76 CDD:304450
Tryp_SPc 248..481 CDD:304450 41/162 (25%)
Tryp_SPc 248..478 CDD:214473 41/162 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.