DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG15046

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_573298.1 Gene:CG15046 / 32833 FlyBaseID:FBgn0030927 Length:494 Species:Drosophila melanogaster


Alignment Length:231 Identity:52/231 - (22%)
Similarity:85/231 - (36%) Gaps:57/231 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVD----AGFKH--- 128
            |...::|.:|:::||.| ....|.|..:.:.....::          |:::.|    ..|:.   
  Fly   281 CAALVLTPQLLVSAAGC-ERPSHAVFGVADLRDVDAD----------EDYLADIVRLVQFQKDLS 334

  Fly   129 --KLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSD 191
              :|.||         |||........::.|||..::   ...|.:...|.|.||||.:   |:|
  Fly   335 LIRLQDP---------LRLGSQTSANVSVAPICTQFE---LTRLQRSGSLVAVGWGKGE---DTD 384

  Fly   192 A-LQTLDIRRQPPDVCAKFIG----QTIAGNQFCAGNWD--------SN-----LCNGDSGGPLG 238
            . |..:.:|.:|...|.....    |.:..:..|....|        ||     .|....|..|.
  Fly   385 CPLFEMPMRLRPTWACGDLPNYGGVQDLGSSHLCVEPMDGERELQRFSNSSTCAACPASVGSVLH 449

  Fly   239 AVITHKNTQRFVQVGIASYTNRNCQ-KASVFTDVLS 273
            .|  .....|.| :|:|:.|...|: :...||.:||
  Fly   450 LV--RPGGGRCV-IGVATPTGAECEARTMYFTGLLS 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 52/231 (23%)
Tryp_SPc 45..278 CDD:238113 52/231 (23%)
CG15046NP_573298.1 CLIP 35..82 CDD:197829
CLIP 168..215 CDD:197829
Tryp_SPc 274..>379 CDD:304450 25/120 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.