DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and psh

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:320 Identity:90/320 - (28%)
Similarity:123/320 - (38%) Gaps:81/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTALIGVPTFVGIILMFQLLHSG-------CSQFLDPACGIRTQSRT----AYRIINGHTAKYN 54
            |.:..:.||||          .||       |.:..:     |.|.|:    ...|:.|:.....
  Fly   104 MTSGRVDVPTF----------GSGDRPAVAACKKIRE-----RKQQRSGNQLVIHIVGGYPVDPG 153

  Fly    55 SSPWMV---FLHSTTDMFVCGGSLITDKLVLTAAHCF--IANQHLVARLGEYERTRSEECTGYYC 114
            ..|.|.   ::...|| |.||||||..:.|||||||.  .||.....|||.......:.  .|  
  Fly   154 VYPHMAAIGYITFGTD-FRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDH--SY-- 213

  Fly   115 NFREEHMVDAGFK-HKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKID---- 174
                :.:|....| |..|..|.: ||||||.|.:.||..|||||.|:        :.|..|    
  Fly   214 ----QDIVIRSVKIHPQYVGNKY-NDIAILELERDVVETDNIRPACL--------HTDATDPPSN 265

  Fly   175 -LLTATGWG--KTQMESDSDALQTLDIRRQPPDVC----------AKFIGQTIAGNQFCAGNWDS 226
             .....|||  .....:.|..|....:...|.|.|          .:.:.|.:..:..||  .|.
  Fly   266 SKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCA--IDQ 328

  Fly   227 NL----CNGDSGGPLGAVITHKNTQ--RFVQVGIASYTNRNCQKAS--VFTDVLSHAEFI 278
            .|    |.|||||||   |...|.:  .:..:|:.| :...|...:  ::|.|.|:.:||
  Fly   329 KLIADACKGDSGGPL---IHELNVEDGMYTIMGVIS-SGFGCATVTPGLYTRVSSYLDFI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 77/264 (29%)
Tryp_SPc 45..278 CDD:238113 77/263 (29%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 77/264 (29%)
Tryp_SPc 144..387 CDD:238113 79/265 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437456
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.