DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG33160

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:262 Identity:66/262 - (25%)
Similarity:101/262 - (38%) Gaps:65/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCF-------------IANQHLV 95
            |||.||.:......::|  ..||...:|||||:..:.|:|||||.             .:||   
  Fly    33 RIIGGHVSSIKEEKYLV--QVTTSEELCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGASNQ--- 92

  Fly    96 ARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICV 160
              .|.|...|:.:    |...|.:           ::..|...|:|.|||:..:: ..||..|.:
  Fly    93 --AGPYAVIRTVD----YIAIRPD-----------FNRKTLNMDVAALRLNSDMI-GANIETIPL 139

  Fly   161 VWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLD------IRRQPPDVC-AKFIG-QTIAGN 217
            .     ...:....|:..:|||..    .:||.:|.:      :.......| :.|.| ..|..:
  Fly   140 A-----AQSVPARALVKVSGWGFL----TADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRS 195

  Fly   218 QFCAGN-WDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA--SVFTDVLSHAEFIL 279
            ..||.. :..:.|:|||||||        ..|....||.|: ...|..|  .::|.|....::..
  Fly   196 MVCAARLYKKDSCDGDSGGPL--------VYRGQLAGIVSF-GYGCASALPGIYTSVPEIRDWFQ 251

  Fly   280 RV 281
            ||
  Fly   252 RV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 64/257 (25%)
Tryp_SPc 45..278 CDD:238113 63/256 (25%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 64/256 (25%)
Tryp_SPc 34..253 CDD:238113 63/259 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.