DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and f2

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_005169022.1 Gene:f2 / 325881 ZFINID:ZDB-GENE-030131-4606 Length:635 Species:Danio rerio


Alignment Length:274 Identity:81/274 - (29%)
Similarity:122/274 - (44%) Gaps:50/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SRTAYRIINGHTAKYNSSPWMVFLHSTTDM-FVCGGSLITDKLVLTAAHC---------FIANQH 93
            |.|..||:.|..|:..|:||.|.|:..:.. .:||.|||:|:.:||||||         |..|. 
Zfish   368 SYTGSRIVGGDEAEVASAPWQVMLYKRSPQELLCGASLISDEWILTAAHCILYPPWNKNFTIND- 431

  Fly    94 LVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHAN-DIAILRLSKSVVYRDNIRP 157
            ::.|||::.||:.|.      ...:...:|....|..|:...:.| |||:|.:.|.||:...|.|
Zfish   432 IIVRLGKHSRTKYER------GIEKIVAIDEIIVHPKYNWKENLNRDIALLHMKKPVVFTSEIHP 490

  Fly   158 IC-----VVWDHRWRHYLDKIDLLTATGWGKTQMESDSD------ALQTLDIRRQPPDVCAKFIG 211
            :|     :..:..:..|..::     ||||..:....|:      .||.:.:......:|.....
Zfish   491 VCLPTKSIAKNLMFAGYKGRV-----TGWGNLRESWTSNPTNLPTVLQQIHLPIVDQSICRNSTS 550

  Fly   212 QTIAGNQFCAGNW--DS---NLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQ---KASVF 268
            ..|..|.||||..  ||   :.|.||||||.  |:...:..|:.|:||.|: ...|.   |...:
Zfish   551 VIITDNMFCAGYQPDDSKRGDACEGDSGGPF--VMKSPSDNRWYQIGIVSW-GEGCDRDGKYGFY 612

  Fly   269 TDVLSHAEFILRVW 282
            |.:     |.:|.|
Zfish   613 THL-----FRMRRW 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 76/263 (29%)
Tryp_SPc 45..278 CDD:238113 75/262 (29%)
f2XP_005169022.1 GLA 39..100 CDD:214503
KR 126..206 CDD:214527
KR 228..309 CDD:214527
Thrombin_light 326..373 CDD:286482 2/4 (50%)
Tryp_SPc 373..621 CDD:214473 78/267 (29%)
Tryp_SPc 374..625 CDD:238113 78/268 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.