DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and HPN

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001362370.1 Gene:HPN / 3249 HGNCID:5155 Length:417 Species:Homo sapiens


Alignment Length:279 Identity:80/279 - (28%)
Similarity:119/279 - (42%) Gaps:46/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVAR 97
            ||.|  .....||:.|........||.|.|. .....:|||||::...||||||||.....:::|
Human   153 CGRR--KLPVDRIVGGRDTSLGRWPWQVSLR-YDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSR 214

  Fly    98 LGEYERTRSEECTGYYCNFREEHMVDAGFKHKLY--------DPNT--HANDIAILRLSKSVVYR 152
            ...:....::         ...|.:..|.:..:|        |||:  ::||||::.||..:...
Human   215 WRVFAGAVAQ---------ASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLT 270

  Fly   153 DNIRPICV------VWDHRWRHYLDKIDLLTATGWGKTQ-MESDSDALQTLDIRRQPPDVC--AK 208
            :.|:|:|:      :.|.:         :.|.||||.|| ....:..||...:.....|||  |.
Human   271 EYIQPVCLPAAGQALVDGK---------ICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGAD 326

  Fly   209 FIGQTIAGNQFCAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVF 268
            |.|..|....||||..:..:  |.||||||.....:...|.|:...||.|: ...|   ||..|:
Human   327 FYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSW-GTGCALAQKPGVY 390

  Fly   269 TDVLSHAEFILRVWRMYGK 287
            |.|....|:|.:..:.:.:
Human   391 TKVSDFREWIFQAIKTHSE 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 76/257 (30%)
Tryp_SPc 45..278 CDD:238113 75/256 (29%)
HPNNP_001362370.1 Hepsin-SRCR 51..159 CDD:401275 3/7 (43%)
Tryp_SPc 163..400 CDD:238113 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.