DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Tmprss11b

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_795998.2 Gene:Tmprss11b / 319875 MGIID:2442893 Length:416 Species:Mus musculus


Alignment Length:285 Identity:75/285 - (26%)
Similarity:119/285 - (41%) Gaps:45/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GIILMFQLLHSGCSQFLDPACGIRTQSRTAY-RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLI 76
            |.:.:.::......:.::..||.|.:....| ||..|.||.....||...|. ......||.|||
Mouse   152 GSLKLTEISKVDAEKIINNRCGRRPRMSATYDRITGGSTAHKGEWPWQASLR-VNGKHYCGASLI 215

  Fly    77 TDKLVLTAAHCFIAN---QHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHAN 138
            .::.:|||||||...   ::|....|    ||   .|..|.    :|.|.....|:.|....|.:
Mouse   216 GERFLLTAAHCFQGTNNPKNLTVSFG----TR---VTPAYM----QHSVQEIIIHEDYVKGEHHD 269

  Fly   139 DIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDL------LTATGWGKTQMESDSD-ALQTL 196
            |:|:::|::.|.:.:::..:|:.         :...:      :..||||.......|. .||..
Mouse   270 DVAVIKLTEKVSFNNDVHRVCLP---------ESTQIFPPGEGVVVTGWGSFSYNGKSPLLLQKA 325

  Fly   197 DIRRQPPDVC--AKFIGQTIAGNQFCAGNWDSNL--CNGDSGGPLGAVITHKNTQR-FVQVGIAS 256
            .|:....:.|  .:..|..|.....|||..:.::  |.|||||||    .|.|::. :..|||.|
Mouse   326 SIKIIDTNTCNSEEAYGGRIVDTMLCAGYLEGSIDACQGDSGGPL----VHPNSRDIWYLVGIVS 386

  Fly   257 YTNRNC---QKASVFTDVLSHAEFI 278
            : ...|   .|..|:..|.|:..:|
Mouse   387 W-GHECGRVNKPGVYMRVTSYRNWI 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/251 (27%)
Tryp_SPc 45..278 CDD:238113 68/250 (27%)
Tmprss11bNP_795998.2 SEA 46..140 CDD:279699
Tryp_SPc 184..410 CDD:214473 69/251 (27%)
Tryp_SPc 185..413 CDD:238113 69/252 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.