DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG31827

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:272 Identity:75/272 - (27%)
Similarity:123/272 - (45%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQS--RTAYRIINGHTAKYNSSPWMV-FLHSTTDMFVCGGSLITDKLVLTAAHCFIAN--Q 92
            ||.....  :..:.:..|. ||....||.: .:|:.:  .|.||||||..:||||||.....  :
  Fly    31 CGYGNPDAVKVQFNVTEGQ-AKPAEFPWTIAVIHNRS--LVGGGSLITPDIVLTAAHRIFNKDVE 92

  Fly    93 HLVARLGEYERTRSEECTGYYCNFREEHMVDAGFK-----HKLYDPNTHANDIAILRLSKSVVYR 152
            .:|...||:|          |.:..|::..:..|.     ||.::....||::|:|.|.:.....
  Fly    93 DIVVSAGEWE----------YGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLT 147

  Fly   153 DNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDS---DALQTLDIRRQPPDVCAKFIGQTI 214
            ..|..||:....|   .|.....:.| ||||.|. ||:   ..|:.:|:...|..:|...:.:|.
  Fly   148 YKINTICLPTQKR---SLSSTRCIVA-GWGKYQF-SDTHYGGVLKKIDLPIVPRHICQDQLRKTR 207

  Fly   215 AGNQF-------CA-GNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASV---F 268
            .|..:       || |..|::.|.||.||.|...:| ::.::|.|:||.:: ...|::.:|   :
  Fly   208 LGQNYTLPRGLICAGGEKDNDACTGDGGGALFCPMT-EDPKQFEQIGIVNW-GVGCKEKNVPATY 270

  Fly   269 TDVLSHAEFILR 280
            |||.....:|::
  Fly   271 TDVFEFKPWIVQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 72/255 (28%)
Tryp_SPc 45..278 CDD:238113 72/254 (28%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 72/252 (29%)
Tryp_SPc 50..280 CDD:214473 71/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.