DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG31269

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:212 Identity:60/212 - (28%)
Similarity:84/212 - (39%) Gaps:45/212 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHC----FIANQHLVARLGEYERT 104
            |||.|..|:...:|:.:.|...:....|||::|.:..|||||||    ||....:|....:|.:.
  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQP 101

  Fly   105 RSE---ECTGYYCNFREEHMVDAGFKHKLYD-PNTHANDIAILRLSKSVVYRDNIRPICVVWDHR 165
            ...   :....:||               || |..| ||||:|.|         :.||  .||.|
  Fly   102 GGRYFLKAIHIHCN---------------YDNPEMH-NDIALLEL---------VEPI--AWDER 139

  Fly   166 WRHY------LDKIDLLTATGWGKTQMESDSDA-LQTLDIRRQPPDVCAKFIG---QTIAGNQFC 220
            .:..      :...|.:..||||.|.:...|.. ||.|.::..|...|...:.   ....|:...
  Fly   140 TQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICT 204

  Fly   221 AGNWDSNLCNGDSGGPL 237
            ........|:|||||||
  Fly   205 FSRLGEGACHGDSGGPL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 60/212 (28%)
Tryp_SPc 45..278 CDD:238113 59/211 (28%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 60/212 (28%)
Tryp_SPc 38..258 CDD:238113 59/211 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.