DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and sphinx1

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:255 Identity:59/255 - (23%)
Similarity:105/255 - (41%) Gaps:36/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QSRTAYRIINGHTAKYNSSPWMV----FLHSTTDMFVCGGSLITDKLVLTA----AHCFIANQHL 94
            :::.:.||..|:.||..:..::|    |...|:.:....|::|:::.:||.    .:.:| ..||
  Fly    19 KNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTVKTVLKYSYI-EVHL 82

  Fly    95 VARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPIC 159
            .:|       ||      |..|....:....|:.. || |.|.  ||:::.......|...|...
  Fly    83 ASR-------RS------YRGFDIIRIYKENFRFH-YD-NDHV--IALVKCPYQKFDRRMDRVRV 130

  Fly   160 VVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFC-AGN 223
            ..:|.|:..|:..:.::...|..|...:. .:.::.:::.......|||:. ..:...:.| :|.
  Fly   131 PAYDTRFERYVGNMTMVCGYGTEKRHAKL-PEWMRCIEVEVMNNTECAKYY-TPLKWYEMCTSGE 193

  Fly   224 WDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQ--KASVFTDVLSHAEFILRV 281
            ....:|.||.|   |||:|......|  :||......||.  ..||...|..|.::|.||
  Fly   194 GFKGVCEGDIG---GAVVTMGPNPTF--IGIIWLMPENCSIGYPSVHIRVSDHIKWIKRV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 56/244 (23%)
Tryp_SPc 45..278 CDD:238113 55/243 (23%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 56/244 (23%)
Tryp_SPc 26..248 CDD:304450 56/246 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.