DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG32260

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:265 Identity:75/265 - (28%)
Similarity:120/265 - (45%) Gaps:33/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFL------HSTTDMFVCGGSLITDKLVLTAAHCFIAN 91
            |||  ...|:.|::.|..|:..:.||:..|      :.....|:||||||..:.|:|:|||....
  Fly   318 CGI--SGATSNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAHCINPM 380

  Fly    92 QHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIR 156
            ..|| |||.::.::..|........|...:      |:.:|.|:.:||||::.|:.......||.
  Fly   381 LTLV-RLGAHDLSQPAESGAMDLRIRRTVV------HEHFDLNSISNDIALIELNVVGALPGNIS 438

  Fly   157 PICVVWDHRWRHYLDKIDLLT-ATGWGKTQMESDSDAL----QTLDIRRQPPDVCAKFIGQTIAG 216
            |||:....::... |.:.:.. ..|||..:.:..:..:    |...:.|...:...|.|.|.:  
  Fly   439 PICLPEAAKFMQQ-DFVGMNPFVAGWGAVKHQGVTSQVLRDAQVPIVSRHSCEQSYKSIFQFV-- 500

  Fly   217 NQF-----CAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKAS---VFTDVLS 273
             ||     |||:...:.|.|||||||.......|..||..:|:.|: ...|.:.:   |:|.|.|
  Fly   501 -QFSDKVLCAGSSSVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSF-GYECARPNFPGVYTRVAS 563

  Fly   274 HAEFI 278
            :..:|
  Fly   564 YVPWI 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 70/252 (28%)
Tryp_SPc 45..278 CDD:238113 69/251 (27%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 70/252 (28%)
Tryp_SPc 328..571 CDD:238113 70/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.