DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Prss40

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001101679.1 Gene:Prss40 / 316318 RGDID:1561330 Length:376 Species:Rattus norvegicus


Alignment Length:326 Identity:78/326 - (23%)
Similarity:117/326 - (35%) Gaps:98/326 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQH 93
            |...|| :||.:.  :|..|..|.....||...|. .....:||..||....|.:|||||    .
  Rat    58 LSMVCG-KTQFQG--KIYGGQIAGAQRWPWQASLR-LYGRHICGAVLIDKNWVASAAHCF----Q 114

  Fly    94 LVARLGEYE----RTRSEECTGYYCNFREEHMVDAGFKHKLYDP-NTHANDIAILRLSKSVVYRD 153
            :....|:|:    .|:....|.|......:.::    .||.|:. ....:||.:|:|..||.|..
  Rat   115 MSRNPGDYQIMLGYTKLNSPTRYSRKMSVKKLI----VHKDYNKFYPQGSDIVLLQLHSSVEYSS 175

  Fly   154 NIRPICV------------VWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPP--- 203
            :|.|.||            .|               .:|||..:.          |:|...|   
  Rat   176 HILPACVPNKNITIPKEKACW---------------TSGWGNLRE----------DVRLPLPNDL 215

  Fly   204 ----------DVCAKFIGQTIAG---------NQFCAGNWD--SNLCNGDSGGPLGAVITHKNTQ 247
                      |.|..|....:.|         :..||.::.  .::|:|||||||..::...   
  Rat   216 YEAELIIMSNDDCKGFFPPPVPGSSKTYYIYDDMVCAADYSLTKSICSGDSGGPLVCLLEGS--- 277

  Fly   248 RFVQVGIASYTNRNCQKASVFTDVLSHAEFILRV-----WRMYGK---GQTLPIPK-KPPTTTRP 303
             :..||:.|::: :|:      |.:|......||     |....|   |.:.|... :||...||
  Rat   278 -WYVVGLTSWSS-SCE------DPISSPSVFARVSYFDKWISDNKKASGDSKPGESYRPPHHQRP 334

  Fly   304 P 304
            |
  Rat   335 P 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 62/274 (23%)
Tryp_SPc 45..278 CDD:238113 62/273 (23%)
Prss40NP_001101679.1 Tryp_SPc 70..310 CDD:214473 64/284 (23%)
Tryp_SPc 71..313 CDD:238113 65/286 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.