DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Ovch2

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_003749007.2 Gene:Ovch2 / 308919 RGDID:1564636 Length:579 Species:Rattus norvegicus


Alignment Length:290 Identity:71/290 - (24%)
Similarity:126/290 - (43%) Gaps:44/290 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGIILMFQLLHSGCSQFLDPACG---IRTQSRTAY----RIINGHTAKYNSSPWMVFLHSTTDMF 69
            :||:.:.|...:..|....|.||   ::...:..:    ||:.|...:..|.||.|.| ......
  Rat    12 LGIVCLEQGHSATLSSIRAPDCGKSLVKPWPQNYFSLFSRIVGGSQVEKGSYPWQVSL-KQKQKH 75

  Fly    70 VCGGSLITDKLVLTAAHCFIANQHLVARL----GEYERTRSEECTGYYCNFREEHMVDAGFKHKL 130
            :|||::|:.:.|:||||| :||:::...|    ||::.:::|  .|......|..::...|..| 
  Rat    76 ICGGTIISSQWVITAAHC-MANRNIALTLNVTAGEHDLSQAE--PGEQTLAIETIIIHPQFSTK- 136

  Fly   131 YDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGK-TQMESDSDALQ 194
             .|..:  |||:|::..:..:...:||:|:   .......:...:.|..|||: ::..|....||
  Rat   137 -KPMNY--DIALLKMVGTFQFGQFVRPVCL---PEPGEQFNAGYICTTAGWGRLSEGGSLPQVLQ 195

  Fly   195 TLDIRRQPPDVCAKF---IGQTIAGNQF-CAGNWDS--NLCNGDSGGPLGAVITHKNTQRFVQVG 253
            .:::.....:.|...   :...|.|..| |.|:.|.  :.|.|||||.|   :.......:...|
  Rat   196 QVNLPILTHEECEAVMLTLRNPITGKTFLCTGSPDGGRDACQGDSGGSL---MCQNRKGAWTLAG 257

  Fly   254 IASY-------TNRNCQK-----ASVFTDV 271
            :.|:       ...|.:|     ..:|||:
  Rat   258 VTSWGLGCGRSWRNNARKKEQGSPGIFTDL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 64/251 (25%)
Tryp_SPc 45..278 CDD:238113 63/250 (25%)
Ovch2XP_003749007.2 Tryp_SPc 52..297 CDD:238113 63/250 (25%)
CUB 317..420 CDD:238001
CUB 431..541 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.