DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Klk8

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:283 Identity:69/283 - (24%)
Similarity:112/283 - (39%) Gaps:70/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PACGIRT--------------QSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLV 81
            |.|.|:|              ......:|:.|...|.:|.||...|.. .:..||||.|:.|:.|
  Rat     5 PPCAIQTWILLFLLMGAWAGLTRAQGSKILEGQECKPHSQPWQTALFQ-GERLVCGGVLVGDRWV 68

  Fly    82 LTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLY---DPNTHANDIAIL 143
            ||||||  .......|||::...:.:|.       .:|..|....:|..:   :|..|::||.::
  Rat    69 LTAAHC--KKDKYSVRLGDHSLQKRDEP-------EQEIQVARSIQHPCFNSSNPEDHSHDIMLI 124

  Fly   144 RLSKSVVYRDNIRPI------------CVVWDHRWRHYLDKIDLLTATGWG--KTQMESDSDALQ 194
            ||..|....|.::||            |::                 :|||  .:..|:..:.|.
  Rat   125 RLQNSANLGDKVKPIELANLCPKVGQKCII-----------------SGWGTVTSPQENFPNTLN 172

  Fly   195 TLDIRRQPPDVCAKFIGQTIAGNQFCAGNWD-SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYT 258
            ..:::....:.|.:.....|.....|||:.: ::.|.|||||||        ....|..||.|:.
  Rat   173 CAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPL--------VCNGVLQGITSWG 229

  Fly   259 NRNC---QKASVFTDVLSHAEFI 278
            :..|   :|..|:|.:..:..:|
  Rat   230 SDPCGKPEKPGVYTKICRYTNWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 64/254 (25%)
Tryp_SPc 45..278 CDD:238113 64/253 (25%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 64/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.