DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Klk12

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:276 Identity:75/276 - (27%)
Similarity:110/276 - (39%) Gaps:65/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFL-HSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVA 96
            |.:........:|.||.....||.||.|.| |.  ....|||.|:..|.|||||||  :.:::| 
  Rat    10 CVVGLSQADREKIYNGVECVKNSQPWQVGLFHG--KYLRCGGVLVDRKWVLTAAHC--SGKYMV- 69

  Fly    97 RLGEYERTRSEECTGYYCNFREE-HMVDAGFKHKLYDP--NTHANDIAILRLSKSVVYRDNIRPI 158
            ||||:..::        .:..|: .:......|..|..  ..|.:|:.:|||::.:.....:||:
  Rat    70 RLGEHSLSK--------LDLTEQLRLTTFSITHPSYHGAYQNHEHDLRLLRLNRPISLTYAVRPV 126

  Fly   159 ------------CVVWDHRWRHYLDKIDLLTATGWGKTQMESD--SDALQTLDIRRQPPDVCAKF 209
                        |.:                 :|||.|....|  .|.||.||:.....:.|...
  Rat   127 ALPSSCAPTGAKCHI-----------------SGWGTTNKPWDPFPDRLQCLDLSIVSNETCRAV 174

  Fly   210 IGQTIAGNQFCA-GNWDSNLCNGDSGGPL--GAVITHKNTQRFVQVGIASYTNRN-C-QKA--SV 267
            ....:..|..|| |....:.|.|||||||  |.|:.          |:.|:.:.. | ||.  .|
  Rat   175 FPGRVTENMLCAGGEAGKDACQGDSGGPLVCGGVLQ----------GLVSWGSVGPCGQKGIPGV 229

  Fly   268 FTDVLSHAEFILRVWR 283
            :|.|..:.::|..|.|
  Rat   230 YTKVCKYTDWIRVVIR 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 71/258 (28%)
Tryp_SPc 45..278 CDD:238113 71/257 (28%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 71/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.