DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and bfb

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_571316.1 Gene:bfb / 30489 ZFINID:ZDB-GENE-990415-34 Length:456 Species:Danio rerio


Alignment Length:234 Identity:41/234 - (17%)
Similarity:69/234 - (29%) Gaps:98/234 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 GYY-------CNFREEHMVDAGFKHKLYDPNTHANDIA----ILRLSKSVVYRDNIRPICVVWDH 164
            |||       |.|            .|:.|||.....|    |...:..|:....:.|      :
Zfish    60 GYYPSIPTRRCQF------------GLWTPNTSTRKKAECKKITCPTPRVLENGEVAP------Y 106

  Fly   165 RWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCA--GNWDSN 227
            :.|:|::::...:..                       ||.  ||.|..:   :.|.  |.|:.:
Zfish   107 QERYYINEVTTYSCN-----------------------PDY--KFRGSKV---RVCQSNGKWNGS 143

  Fly   228 --LCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASVFTDVLSHAEFIL-----RVWRMY 285
              :|..||             ......|:...::|.....::..:|..|.:..|     :|.:..
Zfish   144 TPICERDS-------------DHCPDPGVPPGSSRTGSTFNIDDEVTYHCDSPLTLIGSKVRKCQ 195

  Fly   286 GKGQTLPIPKKPPTTTRPPTWWHTTRIPKQTFQDYDYDT 324
            ..||                 |..|.  .|.:.|:.|||
Zfish   196 DGGQ-----------------WSGTE--PQCYADFTYDT 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 30/181 (17%)
Tryp_SPc 45..278 CDD:238113 30/181 (17%)
bfbNP_571316.1 Sushi 29..77 CDD:278512 6/28 (21%)
CCP 92..148 CDD:153056 12/89 (13%)
CCP 154..207 CDD:153056 10/71 (14%)
vWFA 254..450 CDD:294047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.